PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00215.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 424aa    MW: 47004.5 Da    PI: 5.936
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00215.1_g00028.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.22.9e-075081334
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                              ++C+++++++++  C++++  lC++C    H
  Rsa1.0_00215.1_g00028.1 50 SQICDNCGNEPVSVRCFTDGLVLCQECDWDVH 81
                             689************************97777 PP

2CCT66.95.5e-23375418144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              R++a++RYkeKrktR+++K+irYesRKa+A++R RvKGrFvk++
  Rsa1.0_00215.1_g00028.1 375 RDNAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVKGRFVKAT 418
                              899***************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.1E-11552IPR000315B-box-type zinc finger
PROSITE profilePS501199.556552IPR000315B-box-type zinc finger
CDDcd000212.29E-7852No hitNo description
PROSITE profilePS501198.5744881IPR000315B-box-type zinc finger
PfamPF006432.1E-55081IPR000315B-box-type zinc finger
CDDcd000212.72E-85281No hitNo description
SMARTSM003362.75396IPR000315B-box-type zinc finger
PfamPF062032.2E-17375417IPR010402CCT domain
PROSITE profilePS5101715.11375417IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MSSTTERVPC DFCNERAAVL FCRADAAKLC LPCDHHVHTA NLLSRKHVRS QICDNCGNEP  60
VSVRCFTDGL VLCQECDWDV HGSCSSVSDA HVRSVVEGFA GCPSALELAE LWGIDLEGMK  120
EEKKQVLLPM MMESFGMQLD SWISGSDIMQ QELVVPVPKE TTAFKKGGST SCGRYKQVLC  180
KQLEEMLKSG VVDGGNGERE GEGEGGEGTM VPERLGWRRD EEEISGGGEV NQQQPQTTSF  240
TSLLWNAANP SDGQRQSTQI WDFNLGQSRE PEDTSRVEAA AYDIKDAASF KIKKNDTCST  300
KAKGVKEICQ DDYNQSTTSG QVSENSNHPT TFGSEKGSNS SGELHFAETI AGTSCNKTTR  360
LVPTKADLEQ LAQNRDNAMQ RYKEKRKTRR YDKTIRYESR KARADTRLRV KGRFVKATEA  420
PYYP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1891941e-151AC189194.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB003O07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109761.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 15
SwissprotQ9C7E80.0COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15
TrEMBLM4D3550.0M4D355_BRARP; Uncharacterized protein
STRINGBra010908.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28050.10.0B-box type zinc finger protein with CCT domain